PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1647_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 289aa    MW: 32028.1 Da    PI: 8.4575
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1647_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-124891146
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qk
  cra_locus_1647_iso_1_len_1453_ver_3 48 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQK 91
                                         789*****************77.*********.**********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.31E-144291IPR009057Homeodomain-like
PROSITE profilePS5129413.2844397IPR017930Myb domain
TIGRFAMsTIGR015577.2E-164691IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-64788IPR009057Homeodomain-like
SMARTSM007172.4E-104795IPR001005SANT/Myb domain
PfamPF002491.9E-104891IPR001005SANT/Myb domain
CDDcd001675.75E-85091No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGLPGLHSLQ PVTNSNIAGQ NSNNSGSGVA ADDPSKKVRK PYTITKSRES WTEQEHDKFL  60
EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ KAPKNAVHQV GGLVPSSSSL VEPTYVIRPD  120
SLSVPRNSFS NAALSPWTYN SAPTATMSHM SKDDVGLGGS IVVHNNSSSS NESTPRIWPL  180
NESNDQLKEK NKLPARMIPD FSQVYSFIGS IFDPSAKGDH LQRLRKMDPI NVETVLMLMR  240
NLSVNLMSPE FEDHRRVIVS YSVGREEDKE NVPNDIIKSI NRGNADICM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776267.11e-106PREDICTED: protein REVEILLE 6 isoform X3
SwissprotQ8H0W35e-76RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A068UME01e-131A0A068UME0_COFCA; Uncharacterized protein
STRINGVIT_15s0046g02260.t011e-105(Vitis vinifera)